Blend CagriSema 5/5mg

$139.96

+ Free Shipping

Buy 2 Get 1 Free Blend CagriSema 5/5mg

Blend CagriSema 5/5mg – High-Purity Research Peptides

Welcome to our comprehensive resource on Blend CagriSema 5/5mg. As a premier supplier of laboratory-grade compounds, we specialize in providing Blend CagriSema 5/5mg that exceeds 99% purity, ensuring your research yields accurate and reproducible data. Our Blend CagriSema 5/5mg is intended strictly for in vitro and in vivo scientific research.

What is Blend CagriSema 5/5mg?

Blend CagriSema 5/5mg is a sophisticated synthetic peptide used in advanced biochemical research. When you buy Blend CagriSema 5/5mg from a reputable source, you are investing in a molecule synthesized through Solid-Phase Peptide Synthesis (SPPS). This method allows for precise control over the amino acid sequence, resulting in a high-fidelity product suitable for complex research models.

Blend CagriSema 5/5mg Specifications & Data

Attribute Technical Details
Unit Size 10 mg/vial
Unit Quantity 1 vial
Purity (Mass Spectrometry and UV) 99.75%
Sequence (Cagrilintide) XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
Sequence (Semaglutide) HXEGTFTSDVSSYLEGQAAKEFIAWLVRGRG
Molecular Formula(Cagrilintide) C194H312N54O59S2
Molecular Formula (Semaglutide) C187H291N45O59
Appearance Lyophilized White Powder
Source Chemical Synthesis
Storage Lyophilized Blend CagriSema is stable at roomTemperature for 90 days, however it is best to store in a freezerbelow – 8c for any extended period of time.
Terms The products we offer are intended for laboratoryresearch use only. Please familiarize yourself withour terms of service prior to ordering.

Scientific Research Potential

Peer-reviewed studies suggest that Blend CagriSema 5/5mg exhibits significant potential in the following research domains:

  • Molecular Signaling: Analyzing the interaction of Blend CagriSema 5/5mg with cellular receptors to trigger physiological responses.
  • Tissue Regeneration: Investigating the structural influence of the peptide on extracellular matrix components.
  • Metabolic Pathways: Exploring how Blend CagriSema 5/5mg modulates enzyme activity and metabolic homeostasis.

Why Purchase Blend CagriSema 5/5mg for Your Lab?

Finding a reliable place to buy Blend CagriSema 5/5mg online can be challenging. We offer a “gold standard” service for scientific institutions:

  • Verified Purity: Every vial is tested via HPLC and Mass Spectrometry to guarantee 99%+ purity.
  • Rapid Shipping: We provide expedited shipping across the United States to keep your research on schedule.
  • Wholesale Pricing: Competitive pricing for bulk orders of Blend CagriSema 5/5mg is available for academic and private laboratories.

Storage and Handling Protocols

Proper storage is vital for peptide stability. Store lyophilized Blend CagriSema 5/5mg at -20°C for long-term preservation. Once reconstituted with bacteriostatic water, it should be refrigerated at 2-8°C and used within a short duration to minimize degradation.

Enhance your laboratory research by exploring these complementary compounds:

External Scientific References

For in-depth analysis of existing literature on this compound, visit the following external link:

image x 24 1.jpgBlend CagriSema 5/5mg
$139.96